SCOP 1.55: Domain d1cicb1: 1cic B:1-117

Lineage for d1cicb1 (1cic B:1-117)

Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
Species Anti-idiotope (D1.3) Fab E225, (mouse), kappa L chain [48785] (1 PDB entry)
Domain d1cicb1: 1cic B:1-117 [19965]
Other proteins in same PDB: d1cica2, d1cicb2, d1cicc2, d1cicd2

Details for d1cicb1

PDB Entry: 1cic (more details), 2.5 Å

PDB Description: idiotope-anti-idiotope fab-fab complex; d1.3-e225

SCOP Domain Sequences for d1cicb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cicb1 b.1.1.1 (B:1-117) Immunoglobulin (variable domains of L and H chains) {Anti-idiotope (D1.3) Fab E225, (mouse), kappa L chain}
qvqlqqpgselvrpgasvklsckasgytftnywmhwvkqrpgqglewigniypgsgdsny
dekfkskatltvdtssstaymqlsgltsedsavyycarglafyfdhwgqgttltvss

SCOP Domain Coordinates for d1cicb1:

Click to download the PDB-style file with coordinates for d1cicb1.
(The format of our PDB-style files is described here.)

Timeline for d1cicb1: