Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
Species Anti-idiotope (D1.3) Fab E225, (mouse), kappa L chain [48785] (1 PDB entry) |
Domain d1cicb1: 1cic B:1-117 [19965] Other proteins in same PDB: d1cica2, d1cicb2, d1cicc2, d1cicd2 |
PDB Entry: 1cic (more details), 2.5 Å
SCOP Domain Sequences for d1cicb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cicb1 b.1.1.1 (B:1-117) Immunoglobulin (variable domains of L and H chains) {Anti-idiotope (D1.3) Fab E225, (mouse), kappa L chain} qvqlqqpgselvrpgasvklsckasgytftnywmhwvkqrpgqglewigniypgsgdsny dekfkskatltvdtssstaymqlsgltsedsavyycarglafyfdhwgqgttltvss
Timeline for d1cicb1: