Lineage for d3kprf1 (3kpr F:1-181)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2182691Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2182957Species Human (Homo sapiens), HLA-BW44 [TaxId:9606] [102837] (19 PDB entries)
    Uniprot P30481 25-300
  8. 2182977Domain d3kprf1: 3kpr F:1-181 [199649]
    Other proteins in same PDB: d3kpra2, d3kprb_, d3kprd1, d3kprd2, d3kpre1, d3kpre2, d3kprf2, d3kprg_, d3kpri1, d3kpri2, d3kprj1, d3kprj2
    automated match to d1syva2

Details for d3kprf1

PDB Entry: 3kpr (more details), 2.6 Å

PDB Description: crystal structure of the lc13 tcr in complex with hla b*4405 bound to eeylkawtf a mimotope
PDB Compounds: (F:) HLA class I histocompatibility antigen, B-44 alpha chain

SCOPe Domain Sequences for d3kprf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kprf1 d.19.1.1 (F:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-BW44 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfitvgyvddtlfvrfdsdatsprkeprapwieqegpeyw
dretqisktntqtyrenlrtalryynqseagshiiqrmygcdvgpdgrllrgydqyaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqdrayleglcveslrrylengketlq
r

SCOPe Domain Coordinates for d3kprf1:

Click to download the PDB-style file with coordinates for d3kprf1.
(The format of our PDB-style files is described here.)

Timeline for d3kprf1: