SCOPe 2.06: Domain d3kpre2: 3kpr E:119-247

Lineage for d3kpre2 (3kpr E:119-247)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein T-cell antigen receptor [49125] (7 species)

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (29 PDB entries)

8. Domain d3kpre2: 3kpr E:119-247 [199648]
   Other proteins in same PDB: d3kpra1, d3kpra2, d3kprb_, d3kprd1, d3kpre1, d3kprf1, d3kprf2, d3kprg_, d3kpri1, d3kprj1
   automated match to d1mi5e2

Details for d3kpre2

PDB Entry: 3kpr, 2.6 Å

PDB Description: crystal structure of the lc13 tcr in complex with hla b*4405 bound to eeylkawtf a mimotope

PDB Compounds: (E:) LC13 TCR beta chain

SCOPe Domain Sequences for d3kpre2:

Sequence; same for both SEQRES and ATOM records:

>d3kpre2 b.1.1.2 (E:119-247) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

Timeline for d3kpre2:

• d3kpre2 first appeared in SCOPe 2.03
  
• d3kpre2 appears in SCOPe 2.05
  
• d3kpre2 appears in SCOPe 2.07
  
• d3kpre2 appears in the current release, SCOPe 2.08