Lineage for d3kpre2 (3kpr E:119-247)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749668Protein T-cell antigen receptor [49125] (7 species)
  7. 2749711Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (46 PDB entries)
  8. 2749756Domain d3kpre2: 3kpr E:119-247 [199648]
    Other proteins in same PDB: d3kpra1, d3kpra2, d3kprb_, d3kprd1, d3kpre1, d3kprf1, d3kprf2, d3kprg_, d3kpri1, d3kprj1
    automated match to d1mi5e2

Details for d3kpre2

PDB Entry: 3kpr (more details), 2.6 Å

PDB Description: crystal structure of the lc13 tcr in complex with hla b*4405 bound to eeylkawtf a mimotope
PDB Compounds: (E:) LC13 TCR beta chain

SCOPe Domain Sequences for d3kpre2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kpre2 b.1.1.2 (E:119-247) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

SCOPe Domain Coordinates for d3kpre2:

Click to download the PDB-style file with coordinates for d3kpre2.
(The format of our PDB-style files is described here.)

Timeline for d3kpre2: