SCOPe 2.05: Domain d3kpre1: 3kpr E:3-118

Lineage for d3kpre1 (3kpr E:3-118)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (29 PDB entries)

8. Domain d3kpre1: 3kpr E:3-118 [199647]
   Other proteins in same PDB: d3kpra1, d3kpra2, d3kprb_, d3kprd2, d3kpre2, d3kprf1, d3kprf2, d3kprg_, d3kpri2, d3kprj2
   automated match to d1mi5e1

Details for d3kpre1

PDB Entry: 3kpr, 2.6 Å

PDB Description: crystal structure of the lc13 tcr in complex with hla b*4405 bound to eeylkawtf a mimotope

PDB Compounds: (E:) LC13 TCR beta chain

SCOPe Domain Sequences for d3kpre1:

Sequence; same for both SEQRES and ATOM records:

>d3kpre1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
gvsqsprykvakrgqdvalrcdpisghvslfwyqqalgqgpefltyfqneaqldksglps
drffaerpegsvstlkiqrtqqedsavylcasslgqayeqyfgpgtrltvte

Timeline for d3kpre1:

• d3kpre1 first appeared in SCOPe 2.03
  
• d3kpre1 appears in SCOPe 2.04
  
• d3kpre1 appears in SCOPe 2.06
  
• d3kpre1 appears in the current release, SCOPe 2.08