| Class b: All beta proteins [48724] (104 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) |
| Species Fab D1.3 (mouse), kappa L chain [48784] (19 PDB entries) |
| Domain d1cicd1: 1cic D:1-116 [19963] Other proteins in same PDB: d1cica2, d1cicb2, d1cicc2, d1cicd2 |
PDB Entry: 1cic (more details), 2.5 Å
SCOP Domain Sequences for d1cicd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cicd1 b.1.1.1 (D:1-116) Immunoglobulin (variable domains of L and H chains) {Fab D1.3 (mouse), kappa L chain}
qvqlkesgpglvapsqslsitctvsgfsltgygvnwvrqppgkglewlgmiwgdgntdyn
salksrlsiskdnsksqvflkmnslhtddtaryycarerdyrldywgqgttltvss
Timeline for d1cicd1: