SCOP 1.57: Domain d1cicd1: 1cic D:1-116

Lineage for d1cicd1 (1cic D:1-116)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Fab D1.3 (mouse), kappa L chain [48784] (19 PDB entries)

8. Domain d1cicd1: 1cic D:1-116 [19963]
   Other proteins in same PDB: d1cica2, d1cicb2, d1cicc2, d1cicd2

Details for d1cicd1

PDB Entry: 1cic, 2.5 Å

PDB Description: idiotope-anti-idiotope fab-fab complex; d1.3-e225

SCOP Domain Sequences for d1cicd1:

Sequence; same for both SEQRES and ATOM records:

>d1cicd1 b.1.1.1 (D:1-116) Immunoglobulin (variable domains of L and H chains) {Fab D1.3 (mouse), kappa L chain}
qvqlkesgpglvapsqslsitctvsgfsltgygvnwvrqppgkglewlgmiwgdgntdyn
salksrlsiskdnsksqvflkmnslhtddtaryycarerdyrldywgqgttltvss

Timeline for d1cicd1:

• d1cicd1 first appeared (with stable ids) in SCOP 1.55
  
• d1cicd1 appears in SCOP 1.59
  
• d1cicd1 appears in the current release, SCOPe 2.08