| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest |
Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) ![]() |
| Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins) |
| Protein automated matches [190196] (7 species) not a true protein |
| Species Plasmodium falciparum [TaxId:36329] [189120] (1 PDB entry) |
| Domain d3kkkc_: 3kkk C: [199625] automated match to d3kkkd_ mutant |
PDB Entry: 3kkk (more details), 2.08 Å
SCOPe Domain Sequences for d3kkkc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kkkc_ c.60.1.1 (C:) automated matches {Plasmodium falciparum [TaxId: 36329]}
ttytlvllrhgestwnkenkftgwtdvplsekgeeeaiaagkylkeknfkfdvvytsvlk
raictawnvlktadllhvpvvktwrlnerhcgslqglnksetakkygeeqvkiwrrsydi
pppkldkednrwpghnvvyknvpkdalpfteclkdtvervlpfwfdhiapdilankkvmv
aahgnslrglvkhldnlseadvlelniptgvplvyeldenlkpikhyyll
Timeline for d3kkkc_: