SCOPe 2.06: Domain d3kkkb_: 3kkk B:

Lineage for d3kkkb_ (3kkk B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families)

5. Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)

6. Protein automated matches [190196] (7 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [189120] (1 PDB entry)

8. Domain d3kkkb_: 3kkk B: [199624]
   automated match to d3kkkd_
   mutant

Details for d3kkkb_

PDB Entry: 3kkk, 2.08 Å

PDB Description: y92c catalytic residue mutant of phosphoglycerate mutase from plasmodium falciparum

PDB Compounds: (B:) phosphoglycerate mutase

SCOPe Domain Sequences for d3kkkb_:

Sequence; same for both SEQRES and ATOM records:

>d3kkkb_ c.60.1.1 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
mttytlvllrhgestwnkenkftgwtdvplsekgeeeaiaagkylkeknfkfdvvytsvl
kraictawnvlktadllhvpvvktwrlnerhcgslqglnksetakkygeeqvkiwrrsyd
ipppkldkednrwpghnvvyknvpkdalpfteclkdtvervlpfwfdhiapdilankkvm
vaahgnslrglvkhldnlseadvlelniptgvplvyeldenlkpikhyyll

Timeline for d3kkkb_:

• d3kkkb_ first appeared in SCOPe 2.03
  
• d3kkkb_ appears in SCOPe 2.05
  
• d3kkkb_ appears in SCOPe 2.07
  
• d3kkkb_ appears in the current release, SCOPe 2.08