| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) ![]() consists of one domain of this fold |
| Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
| Protein automated matches [190396] (20 species) not a true protein |
| Species Human immunodeficiency virus type 1 [TaxId:11706] [225515] (17 PDB entries) |
| Domain d3kk3a2: 3kk3 A:430-555 [199622] Other proteins in same PDB: d3kk3a1, d3kk3b_ automated match to d1bqna1 protein/DNA complex; complexed with mg, so4 |
PDB Entry: 3kk3 (more details), 2.9 Å
SCOPe Domain Sequences for d3kk3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kk3a2 c.55.3.0 (A:430-555) automated matches {Human immunodeficiency virus type 1 [TaxId: 11706]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsag
Timeline for d3kk3a2: