Lineage for d1cicc1 (1cic C:1-107)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52252Species Fab D1.3 (mouse), kappa L chain [48784] (19 PDB entries)
  8. 52289Domain d1cicc1: 1cic C:1-107 [19962]
    Other proteins in same PDB: d1cica2, d1cicb2, d1cicc2, d1cicd2

Details for d1cicc1

PDB Entry: 1cic (more details), 2.5 Å

PDB Description: idiotope-anti-idiotope fab-fab complex; d1.3-e225

SCOP Domain Sequences for d1cicc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cicc1 b.1.1.1 (C:1-107) Immunoglobulin (variable domains of L and H chains) {Fab D1.3 (mouse), kappa L chain}
diqmtqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvyytttladgvps
rfsgsgsgtqyslkinslqpedfgsyycqhfwstprtfgggtklelk

SCOP Domain Coordinates for d1cicc1:

Click to download the PDB-style file with coordinates for d1cicc1.
(The format of our PDB-style files is described here.)

Timeline for d1cicc1: