Lineage for d3kk1a1 (3kk1 A:1-429)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2571153Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2571154Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2571504Family e.8.1.2: Reverse transcriptase [56686] (3 protein domains)
  6. 2571505Protein HIV-1 reverse transcriptase [56689] (4 species)
  7. 2571549Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (186 PDB entries)
    Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
  8. 2571604Domain d3kk1a1: 3kk1 A:1-429 [199617]
    Other proteins in same PDB: d3kk1a2
    automated match to d1bqna2
    protein/DNA complex; complexed with 914, mg, so4

Details for d3kk1a1

PDB Entry: 3kk1 (more details), 2.7 Å

PDB Description: HIV-1 reverse transcriptase-DNA complex with nuceotide inhibitor GS-9148-diphosphate bound in nucleotide site
PDB Compounds: (A:) Reverse transcriptase P66 SUBUNIT

SCOPe Domain Sequences for d3kk1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kk1a1 e.8.1.2 (A:1-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndicklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

SCOPe Domain Coordinates for d3kk1a1:

Click to download the PDB-style file with coordinates for d3kk1a1.
(The format of our PDB-style files is described here.)

Timeline for d3kk1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3kk1a2
View in 3D
Domains from other chains:
(mouse over for more information)
d3kk1b_