Class g: Small proteins [56992] (90 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.1: EGF-type module [57197] (23 proteins) |
Protein automated matches [190092] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187310] (65 PDB entries) |
Domain d3k9xa1: 3k9x A:90-126 [199611] Other proteins in same PDB: d3k9xb_, d3k9xd_ automated match to d1xkal1 complexed with ca, gol, mbm, na |
PDB Entry: 3k9x (more details), 1.9 Å
SCOPe Domain Sequences for d3k9xa1:
Sequence, based on SEQRES records: (download)
>d3k9xa1 g.3.11.1 (A:90-126) automated matches {Human (Homo sapiens) [TaxId: 9606]} cetspcqnqgkckdglgeytctclegfegkncelftr
>d3k9xa1 g.3.11.1 (A:90-126) automated matches {Human (Homo sapiens) [TaxId: 9606]} cetspcqnqgkckdeytctclegfegkncelftr
Timeline for d3k9xa1:
View in 3D Domains from other chains: (mouse over for more information) d3k9xb_, d3k9xc1, d3k9xc2, d3k9xd_ |