Lineage for d3k9xa1 (3k9x A:90-126)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031138Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 3031664Protein automated matches [190092] (2 species)
    not a true protein
  7. 3031665Species Human (Homo sapiens) [TaxId:9606] [187310] (69 PDB entries)
  8. 3031709Domain d3k9xa1: 3k9x A:90-126 [199611]
    Other proteins in same PDB: d3k9xb_, d3k9xd_
    automated match to d1xkal1
    complexed with ca, gol, mbm, na

Details for d3k9xa1

PDB Entry: 3k9x (more details), 1.9 Å

PDB Description: x-ray crystal structure of human fxa in complex with (s)-n-((2- methylbenzofuran-5-ylamino)(2-oxo-1-(2-oxo-2- (pyrrolidin-1-yl) ethyl)azepan-3- ylamino)methylene)nicotinamide
PDB Compounds: (A:) protein (coagulation factor x)

SCOPe Domain Sequences for d3k9xa1:

Sequence, based on SEQRES records: (download)

>d3k9xa1 g.3.11.1 (A:90-126) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cetspcqnqgkckdglgeytctclegfegkncelftr

Sequence, based on observed residues (ATOM records): (download)

>d3k9xa1 g.3.11.1 (A:90-126) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cetspcqnqgkckdeytctclegfegkncelftr

SCOPe Domain Coordinates for d3k9xa1:

Click to download the PDB-style file with coordinates for d3k9xa1.
(The format of our PDB-style files is described here.)

Timeline for d3k9xa1: