SCOPe 2.08: Domain d3k9ca_: 3k9c A:

Lineage for d3k9ca_ (3k9c A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (77 species)
   not a true protein

7. Species Rhodococcus jostii [TaxId:101510] [196515] (1 PDB entry)

8. Domain d3k9ca_: 3k9c A: [199610]
   automated match to d3k9cb_
   complexed with gol

Details for d3k9ca_

PDB Entry: 3k9c, 2.14 Å

PDB Description: crystal structure of laci transcriptional regulator from rhodococcus species.

PDB Compounds: (A:) Transcriptional regulator, LacI family protein

SCOPe Domain Sequences for d3k9ca_:

Sequence; same for both SEQRES and ATOM records:

>d3k9ca_ c.93.1.0 (A:) automated matches {Rhodococcus jostii [TaxId: 101510]}
rllgvvfelqqpfhgdlveqiyaaatrrgydvmlsavapsraekvavqalmrerceaail
lgtrfdtdelgaladrvpalvvarasglpgvgavrgddvagitlavdhltelghrniahi
dgadapggadrragflaamdrhglsasatvvtggttetegaegmhtllemptpptavvaf
ndrcatgvldllvrsgrdvpadisvvgyddsrlariphvqmttisqdathmaeaavdgal
aqisgdkavdlvlaphlvrrattgpvah

Timeline for d3k9ca_:

• d3k9ca_ first appeared in SCOPe 2.03
  
• d3k9ca_ appears in SCOPe 2.07