SCOP 1.61: Domain d1fdlh1: 1fdl H:1-116

Lineage for d1fdlh1 (1fdl H:1-116)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Fab D1.3 (mouse), kappa L chain [48784] (19 PDB entries)

8. Domain d1fdlh1: 1fdl H:1-116 [19961]
   Other proteins in same PDB: d1fdlh2, d1fdll2, d1fdly_

Details for d1fdlh1

PDB Entry: 1fdl, 2.5 Å

PDB Description: crystallographic refinement of the three-dimensional structure of the fab d1.3-lysozyme complex at 2.5-angstroms resolution

SCOP Domain Sequences for d1fdlh1:

Sequence; same for both SEQRES and ATOM records:

>d1fdlh1 b.1.1.1 (H:1-116) Immunoglobulin (variable domains of L and H chains) {Fab D1.3 (mouse), kappa L chain}
qvqlkesgpglvapsqslsitctvsgfsltgygvnwvrqppgkglewlgmiwgdgntdyn
salksrlsiskdnsksqvflkmnslhtddtaryycarerdyrldywgqgttltvss

Timeline for d1fdlh1:

• d1fdlh1 first appeared (with stable ids) in SCOP 1.55
  
• d1fdlh1 appears in SCOP 1.59
  
• d1fdlh1 appears in SCOP 1.63
  
• d1fdlh1 appears in the current release, SCOPe 2.08