Lineage for d1fdlh1 (1fdl H:1-116)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740504Species Mouse (Mus musculus), cluster 5 [TaxId:10090] [88555] (36 PDB entries)
  8. 2740529Domain d1fdlh1: 1fdl H:1-116 [19961]
    Other proteins in same PDB: d1fdlh2, d1fdll1, d1fdll2, d1fdly_
    part of Fab D1.3

Details for d1fdlh1

PDB Entry: 1fdl (more details), 2.5 Å

PDB Description: crystallographic refinement of the three-dimensional structure of the fab d1.3-lysozyme complex at 2.5-angstroms resolution
PDB Compounds: (H:) igg1-kappa d1.3 fab (heavy chain)

SCOPe Domain Sequences for d1fdlh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fdlh1 b.1.1.1 (H:1-116) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5 [TaxId: 10090]}
qvqlkesgpglvapsqslsitctvsgfsltgygvnwvrqppgkglewlgmiwgdgntdyn
salksrlsiskdnsksqvflkmnslhtddtaryycarerdyrldywgqgttltvss

SCOPe Domain Coordinates for d1fdlh1:

Click to download the PDB-style file with coordinates for d1fdlh1.
(The format of our PDB-style files is described here.)

Timeline for d1fdlh1: