Lineage for d3k65a_ (3k65 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033267Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 3033268Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 3033269Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 3033399Protein automated matches [226950] (2 species)
    not a true protein
  7. 3033400Species Human (Homo sapiens) [TaxId:9606] [225942] (12 PDB entries)
  8. 3033411Domain d3k65a_: 3k65 A: [199609]
    Other proteins in same PDB: d3k65b_
    automated match to d1a0ha1
    complexed with bu1

Details for d3k65a_

PDB Entry: 3k65 (more details), 1.85 Å

PDB Description: crystal structure of prethombin-2/fragment-2 complex
PDB Compounds: (A:) Prothrombin

SCOPe Domain Sequences for d3k65a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k65a_ g.14.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qcvpdrgqqyqgrlavtthglpclawasaqakalskhqdfnsavqlvenfcrnpdgdeeg
vwcyvagkpgdfgycdlnyc

SCOPe Domain Coordinates for d3k65a_:

Click to download the PDB-style file with coordinates for d3k65a_.
(The format of our PDB-style files is described here.)

Timeline for d3k65a_: