![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.82.1: ALDH-like [53720] (3 families) ![]() binds NAD differently from other NAD(P)-dependent oxidoreductases |
![]() | Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
![]() | Protein automated matches [190683] (38 species) not a true protein |
![]() | Species Pseudoalteromonas atlantica [TaxId:342610] [196520] (1 PDB entry) |
![]() | Domain d3k2wb_: 3k2w B: [199603] automated match to d3k2wh_ complexed with act, cl, gol |
PDB Entry: 3k2w (more details), 1.9 Å
SCOPe Domain Sequences for d3k2wb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k2wb_ c.82.1.0 (B:) automated matches {Pseudoalteromonas atlantica [TaxId: 342610]} ltvqdlhfknkvnfiggqyvpsnesdtidilspstgkvigeipagckadaenalevaqaa qkawakltartrqnmlrtfankirenkhilapmlvaeqgkllsvaemevdvtatfidygc dnaltiegdilpsdnqdekiyihkvprgvvvgitawnfplalagrkigpalitgntmvlk ptqetplattelgriakeaglpdgvlnvingtgsvvgqtlcespitkmitmtgstvagkq iyktsaeymtpvmlelggkapmvvmddadldkaaedalwgrfancgqvctcverlyvhas vydefmakflplvkglkvgdpmdadsqmgpkcnqreidnidhivheaikqgatvatggkt atvegfeggcwyeptvlvdvkqdnivvheetfgpilpivkvssmeqaiefcndsiyglsa yvhtqsfaninqaisdlevgevyinrgmgeqhqgfhngwkqsgfggedgkfgleqylekk tvyineae
Timeline for d3k2wb_: