Lineage for d1fdll1 (1fdl L:1-107)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 451612Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 452039Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (162 PDB entries)
  8. 452136Domain d1fdll1: 1fdl L:1-107 [19960]
    Other proteins in same PDB: d1fdlh1, d1fdlh2, d1fdll2, d1fdly_
    part of Fab D1.3

Details for d1fdll1

PDB Entry: 1fdl (more details), 2.5 Å

PDB Description: crystallographic refinement of the three-dimensional structure of the fab d1.3-lysozyme complex at 2.5-angstroms resolution

SCOP Domain Sequences for d1fdll1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fdll1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
diqmtqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvyytttladgvps
rfsgsgsgtqyslkinslqpedfgsyycqhfwstprtfgggtkleik

SCOP Domain Coordinates for d1fdll1:

Click to download the PDB-style file with coordinates for d1fdll1.
(The format of our PDB-style files is described here.)

Timeline for d1fdll1: