| Class b: All beta proteins [48724] (104 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) |
| Species Fab D1.3 (mouse), kappa L chain [48784] (19 PDB entries) |
| Domain d1fdll1: 1fdl L:1-107 [19960] Other proteins in same PDB: d1fdlh2, d1fdll2, d1fdly_ |
PDB Entry: 1fdl (more details), 2.5 Å
SCOP Domain Sequences for d1fdll1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fdll1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Fab D1.3 (mouse), kappa L chain}
diqmtqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvyytttladgvps
rfsgsgsgtqyslkinslqpedfgsyycqhfwstprtfgggtkleik
Timeline for d1fdll1: