Lineage for d3jz4b_ (3jz4 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (49 species)
    not a true protein
  7. 2141247Species Escherichia coli [TaxId:562] [187807] (4 PDB entries)
  8. 2141250Domain d3jz4b_: 3jz4 B: [199597]
    automated match to d3jz4d_
    complexed with nap

Details for d3jz4b_

PDB Entry: 3jz4 (more details), 2.3 Å

PDB Description: Crystal structure of E. coli NADP dependent enzyme
PDB Compounds: (B:) Succinate-semialdehyde dehydrogenase [NADP+]

SCOPe Domain Sequences for d3jz4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jz4b_ c.82.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
klndsnlfrqqalingewldanngeaidvtnpangdklgsvpkmgadetraaidaanral
pawraltakeratilrnwfnlmmehqddlarlmtleqgkplaeakgeisyaasfiewfae
egkriygdtipghqadkrlivikqpigvtaaitpwnfpaamitrkagpalaagctmvlkp
asqtpfsalalaelairagvpagvfnvvtgsagavgneltsnplvrklsftgsteigrql
meqcakdikkvslelggnapfivfddadldkavegalaskfrnagqtcvcanrlyvqdgv
ydrfaeklqqamsklhigdgldngvtigplidekavakveehiadalekgarvvcggkah
erggnffqptilvdvpanakvskeetfgplaplfrfkdeadviaqandtefglaayfyar
dlsrvfrvgealeygivgintgiisnevapfggikasglgregskygiedyleikymcig
l

SCOPe Domain Coordinates for d3jz4b_:

Click to download the PDB-style file with coordinates for d3jz4b_.
(The format of our PDB-style files is described here.)

Timeline for d3jz4b_: