SCOPe 2.05: Domain d3jvgb2: 3jvg B:181-277

Lineage for d3jvgb2 (3jvg B:181-277)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [188287] (18 PDB entries)

8. Domain d3jvgb2: 3jvg B:181-277 [199592]
   Other proteins in same PDB: d3jvga1, d3jvgb1
   automated match to d1gzqa1
   complexed with cl, nag, unl

Details for d3jvgb2

PDB Entry: 3jvg, 2.2 Å

PDB Description: crystal structure of chicken cd1-1

PDB Compounds: (B:) T-cell surface glycoprotein CD1A1 antigen

SCOPe Domain Sequences for d3jvgb2:

Sequence, based on SEQRES records:

>d3jvgb2 b.1.1.0 (B:181-277) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
qvppmavvfartagqaqlllvcrvtsfyprpiavtwlrdgrevppspalstgtvlpnadl
tyqlrstllvspqdghgyacrvqhcslgdrsllvpwh

Sequence, based on observed residues (ATOM records):

>d3jvgb2 b.1.1.0 (B:181-277) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
qvppmavvfartaqlllvcrvtsfyprpiavtwlrdgrevppspalstgtvlpnadltyq
lrstllvspqdghgyacrvqhcslgrsllvpwh

Timeline for d3jvgb2:

• d3jvgb2 first appeared in SCOPe 2.03
  
• d3jvgb2 appears in SCOPe 2.04
  
• d3jvgb2 appears in SCOPe 2.06
  
• d3jvgb2 appears in the current release, SCOPe 2.08