SCOPe 2.04: Domain d3jvgb1: 3jvg B:6-180

Lineage for d3jvgb1 (3jvg B:6-180)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (4 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [225828] (8 PDB entries)

8. Domain d3jvgb1: 3jvg B:6-180 [199591]
   Other proteins in same PDB: d3jvga2, d3jvgb2, d3jvgc_, d3jvgd_
   automated match to d1gzpa2
   complexed with cl, nag, unl

Details for d3jvgb1

PDB Entry: 3jvg, 2.2 Å

PDB Description: crystal structure of chicken cd1-1

PDB Compounds: (B:) T-cell surface glycoprotein CD1A1 antigen

SCOPe Domain Sequences for d3jvgb1:

Sequence, based on SEQRES records:

>d3jvgb1 d.19.1.0 (B:6-180) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
shmlkllhfatfqnstsvlvgglgllgdvkmgsldsrtgniryyrpwlrpslpkgdwdvi
essiksyvrdfsrlvqmyttvpypfvfqssigcelqsngtirtffdiayegqnflrfnld
agtwdqmqhnqlsakaehlmanastlneviqvllndtcvdilrlfiqagkadler

Sequence, based on observed residues (ATOM records):

>d3jvgb1 d.19.1.0 (B:6-180) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
shmlkllhfatfqnstsvlvgglgllgdvkmgsldsrtgniryyrpwlrpslpkgdwdvi
essiksyvrdfsrlvqmytvpypfvfqssigcelqsngtirtffdiayegqnflrfnlda
gtwdqmqhnqlsakaehlmanastlneviqvllndtcvdilrlfiqagkadler

Timeline for d3jvgb1:

• d3jvgb1 first appeared in SCOPe 2.03
  
• d3jvgb1 appears in SCOPe 2.05
  
• d3jvgb1 appears in the current release, SCOPe 2.08