Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (5 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [225828] (15 PDB entries) |
Domain d3jvgb1: 3jvg B:6-180 [199591] Other proteins in same PDB: d3jvga2, d3jvga3, d3jvgb2, d3jvgb3, d3jvgc_, d3jvgd_ automated match to d1gzpa2 complexed with cl, nag, unl |
PDB Entry: 3jvg (more details), 2.2 Å
SCOPe Domain Sequences for d3jvgb1:
Sequence, based on SEQRES records: (download)
>d3jvgb1 d.19.1.0 (B:6-180) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} shmlkllhfatfqnstsvlvgglgllgdvkmgsldsrtgniryyrpwlrpslpkgdwdvi essiksyvrdfsrlvqmyttvpypfvfqssigcelqsngtirtffdiayegqnflrfnld agtwdqmqhnqlsakaehlmanastlneviqvllndtcvdilrlfiqagkadler
>d3jvgb1 d.19.1.0 (B:6-180) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} shmlkllhfatfqnstsvlvgglgllgdvkmgsldsrtgniryyrpwlrpslpkgdwdvi essiksyvrdfsrlvqmytvpypfvfqssigcelqsngtirtffdiayegqnflrfnlda gtwdqmqhnqlsakaehlmanastlneviqvllndtcvdilrlfiqagkadler
Timeline for d3jvgb1: