Lineage for d3jvgb1 (3jvg B:6-180)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2163004Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2163005Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2163984Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2163985Protein automated matches [226842] (4 species)
    not a true protein
  7. 2163986Species Chicken (Gallus gallus) [TaxId:9031] [225828] (8 PDB entries)
  8. 2163991Domain d3jvgb1: 3jvg B:6-180 [199591]
    Other proteins in same PDB: d3jvga2, d3jvga3, d3jvgb2, d3jvgb3, d3jvgc_, d3jvgd_
    automated match to d1gzpa2
    complexed with cl, nag, unl

Details for d3jvgb1

PDB Entry: 3jvg (more details), 2.2 Å

PDB Description: Crystal Structure of chicken CD1-1
PDB Compounds: (B:) T-cell surface glycoprotein CD1A1 antigen

SCOPe Domain Sequences for d3jvgb1:

Sequence, based on SEQRES records: (download)

>d3jvgb1 d.19.1.0 (B:6-180) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
shmlkllhfatfqnstsvlvgglgllgdvkmgsldsrtgniryyrpwlrpslpkgdwdvi
essiksyvrdfsrlvqmyttvpypfvfqssigcelqsngtirtffdiayegqnflrfnld
agtwdqmqhnqlsakaehlmanastlneviqvllndtcvdilrlfiqagkadler

Sequence, based on observed residues (ATOM records): (download)

>d3jvgb1 d.19.1.0 (B:6-180) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
shmlkllhfatfqnstsvlvgglgllgdvkmgsldsrtgniryyrpwlrpslpkgdwdvi
essiksyvrdfsrlvqmytvpypfvfqssigcelqsngtirtffdiayegqnflrfnlda
gtwdqmqhnqlsakaehlmanastlneviqvllndtcvdilrlfiqagkadler

SCOPe Domain Coordinates for d3jvgb1:

Click to download the PDB-style file with coordinates for d3jvgb1.
(The format of our PDB-style files is described here.)

Timeline for d3jvgb1: