| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Chicken (Gallus gallus) [TaxId:9031] [188287] (28 PDB entries) |
| Domain d3jvga2: 3jvg A:181-276 [199590] Other proteins in same PDB: d3jvga1, d3jvga3, d3jvgb1, d3jvgb3 automated match to d1gzqa1 complexed with cl, nag, unl |
PDB Entry: 3jvg (more details), 2.2 Å
SCOPe Domain Sequences for d3jvga2:
Sequence, based on SEQRES records: (download)
>d3jvga2 b.1.1.0 (A:181-276) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
qvppmavvfartagqaqlllvcrvtsfyprpiavtwlrdgrevppspalstgtvlpnadl
tyqlrstllvspqdghgyacrvqhcslgdrsllvpw
>d3jvga2 b.1.1.0 (A:181-276) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
qvppmavvfartaqlllvcrvtsfyprpiavtwlrdgrevppspalstgtvlpnadltyq
lrstllvsphgyacrvqhcslgrsllvpw
Timeline for d3jvga2: