![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
![]() | Protein automated matches [190151] (166 species) not a true protein |
![]() | Species Neisseria meningitidis [TaxId:122587] [196533] (1 PDB entry) |
![]() | Domain d3jtxa1: 3jtx A:1-395 [199588] Other proteins in same PDB: d3jtxa2 automated match to d3jtxb_ complexed with act, ca, gol, mes |
PDB Entry: 3jtx (more details), 1.91 Å
SCOPe Domain Sequences for d3jtxa1:
Sequence, based on SEQRES records: (download)
>d3jtxa1 c.67.1.0 (A:1-395) automated matches {Neisseria meningitidis [TaxId: 122587]} mntllkqlkpypfarlheamqgisapegmeavplhigepkhptpkvitdaltaslhelek ypltaglpelrqacanwlkrrydgltvdadneilpvlgsrealfsfvqtvlnpvsdgikp aivspnpfyqiyegatllgggeihfancpapsfnpdwrsiseevwkrtklvfvcspnnps gsvldldgwkevfdlqdkygfiiasdecyseiyfdgnkplgclqaaaqlgrsrqkllmft slskrsnvpglrsgfvagdaellknfllyrtyhgsamsipvqrasiaawddeqhvidnrr lyqekfervipilqqvfdvklpdasfyiwlkvpdgddlafarnlwqkaaiqvlpgrflar dteqgnpgegyvrialvadvatcvkaaedivslyr
>d3jtxa1 c.67.1.0 (A:1-395) automated matches {Neisseria meningitidis [TaxId: 122587]} mntllkqlkpypfarlheamqgisapegmeavplhigepkhptpkvitdaltaslhelek ypltaglpelrqacanwlkrrydgltvdadneilpvlgsrealfsfvqtvlnpgikpaiv spnpfyqiyegatllgggeihfancpapsfnpdwrsiseevwkrtklvfvcspnnpsgsv ldldgwkevfdlqdkygfiiasdecyseiyfdgnkplgclqaaaqlgrsrqkllmftsls krsnvpglrsgfvagdaellknfllyrtyhgsamsipvqrasiaawddeqhvidnrrlyq ekfervipilqqvfdvklpdasfyiwlkvpdgddlafarnlwqkaaiqvlpgrflardte qgnpgegyvrialvadvatcvkaaedivslyr
Timeline for d3jtxa1: