Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
Protein automated matches [190683] (59 species) not a true protein |
Species Pea (Pisum sativum) [TaxId:3888] [189187] (2 PDB entries) |
Domain d3iwkk_: 3iwk K: [199587] automated match to d3iwkl_ complexed with gol, mrd, na, nad |
PDB Entry: 3iwk (more details), 2.4 Å
SCOPe Domain Sequences for d3iwkk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iwkk_ c.82.1.0 (K:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} srqlfidgewrvpilnkripninpsteniigdipaatkedvdlavdaakraisrkngrdw saasgslrarylraiaakikekkdelgklesidcgkpleealadlddvvacfeyyaglae eldskqkapislpmdtfksyilkepigvvalitpwnypflmatwkiapalaagcaailkp selasvtclelgeickevglprgvlnivtglgheagaslashpdvdkisftgssatgski mttaaqlvkpvslelggkspivvfedvdldkvaewtvfgcfftngqicsatsrlivhesi avefvdklvkwaenikisdpleegcrlgpivseaqykkvlncissaksegatiltggrrp ehlkkgyfveptiitdvttsmqiwreevfgpvlavktfsteeeainlandthyglgsavm sndlercerlskalqagivwincaqpsfiqapwggikrsgfgrelgewglenylsvkqvt rytsdepwgwyqppsk
Timeline for d3iwkk_: