Lineage for d3iwke_ (3iwk E:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (49 species)
    not a true protein
  7. 2141420Species Pea (Pisum sativum) [TaxId:3888] [189187] (2 PDB entries)
  8. 2141427Domain d3iwke_: 3iwk E: [199581]
    automated match to d3iwkl_
    complexed with gol, mrd, na, nad

Details for d3iwke_

PDB Entry: 3iwk (more details), 2.4 Å

PDB Description: Crystal structure of aminoaldehyde dehydrogenase 1 from Pisum sativum (PsAMADH1)
PDB Compounds: (E:) Aminoaldehyde dehydrogenase

SCOPe Domain Sequences for d3iwke_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iwke_ c.82.1.0 (E:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
srqlfidgewrvpilnkripninpsteniigdipaatkedvdlavdaakraisrkngrdw
saasgslrarylraiaakikekkdelgklesidcgkpleealadlddvvacfeyyaglae
eldskqkapislpmdtfksyilkepigvvalitpwnypflmatwkiapalaagcaailkp
selasvtclelgeickevglprgvlnivtglgheagaslashpdvdkisftgssatgski
mttaaqlvkpvslelggkspivvfedvdldkvaewtvfgcfftngqicsatsrlivhesi
avefvdklvkwaenikisdpleegcrlgpivseaqykkvlncissaksegatiltggrrp
ehlkkgyfveptiitdvttsmqiwreevfgpvlavktfsteeeainlandthyglgsavm
sndlercerlskalqagivwincaqpsfiqapwggikrsgfgrelgewglenylsvkqvt
rytsdepwgwyqppsk

SCOPe Domain Coordinates for d3iwke_:

Click to download the PDB-style file with coordinates for d3iwke_.
(The format of our PDB-style files is described here.)

Timeline for d3iwke_: