![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein automated matches [190041] (34 species) not a true protein |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [189215] (23 PDB entries) |
![]() | Domain d3is7v_: 3is7 V: [199574] automated match to d3is7s_ complexed with hem, k |
PDB Entry: 3is7 (more details), 2.1 Å
SCOPe Domain Sequences for d3is7v_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3is7v_ a.25.1.1 (V:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} gdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklieri lfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllkd ileseeehidyletqlgliqkvglenylqshmhe
Timeline for d3is7v_: