SCOPe 2.02: Domain d1kipb_: 1kip B:

Lineage for d1kipb_ (1kip B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 5 [TaxId:10090] [88555] (36 PDB entries)

8. Domain d1kipb_: 1kip B: [19957]
   Other proteins in same PDB: d1kipa_, d1kipc_
   part of Fv D1.3
   mutant

Details for d1kipb_

PDB Entry: 1kip, 2.1 Å

PDB Description: fv mutant y(b 32)a (vh domain) of mouse monoclonal antibody d1.3 complexed with hen egg white lysozyme

PDB Compounds: (B:) monoclonal antibody d1.3

SCOPe Domain Sequences for d1kipb_:

Sequence; same for both SEQRES and ATOM records:

>d1kipb_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5 [TaxId: 10090]}
qvqlqesgpglvapsqslsitctvsgfsltgagvnwvrqppgkglewlgmiwgdgntdyn
salksrlsiskdnsksqvflkmnslhtddtaryycarerdyrldywgqgttltvss

Timeline for d1kipb_:

• d1kipb_ first appeared (with stable ids) in SCOP 1.55
  
• d1kipb_ appears in SCOPe 2.01
  
• d1kipb_ appears in SCOPe 2.03
  
• d1kipb_ appears in the current release, SCOPe 2.08, called d1kipb1