Lineage for d1kipb1 (1kip B:6-116)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740504Species Mouse (Mus musculus), cluster 5 [TaxId:10090] [88555] (36 PDB entries)
  8. 2740517Domain d1kipb1: 1kip B:6-116 [19957]
    Other proteins in same PDB: d1kipa_, d1kipb2, d1kipc_
    part of Fv D1.3
    mutant

Details for d1kipb1

PDB Entry: 1kip (more details), 2.1 Å

PDB Description: fv mutant y(b 32)a (vh domain) of mouse monoclonal antibody d1.3 complexed with hen egg white lysozyme
PDB Compounds: (B:) monoclonal antibody d1.3

SCOPe Domain Sequences for d1kipb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kipb1 b.1.1.1 (B:6-116) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5 [TaxId: 10090]}
esgpglvapsqslsitctvsgfsltgagvnwvrqppgkglewlgmiwgdgntdynsalks
rlsiskdnsksqvflkmnslhtddtaryycarerdyrldywgqgttltvss

SCOPe Domain Coordinates for d1kipb1:

Click to download the PDB-style file with coordinates for d1kipb1.
(The format of our PDB-style files is described here.)

Timeline for d1kipb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kipb2