Lineage for d3is7l_ (3is7 L:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2702255Protein automated matches [190041] (34 species)
    not a true protein
  7. 2702789Species Pseudomonas aeruginosa [TaxId:287] [189215] (23 PDB entries)
  8. 2703017Domain d3is7l_: 3is7 L: [199565]
    automated match to d3is7s_
    complexed with hem, k

Details for d3is7l_

PDB Entry: 3is7 (more details), 2.1 Å

PDB Description: structure of mineralized bfrb from pseudomonas aeruginosa to 2.1a resolution
PDB Compounds: (L:) bacterioferritin

SCOPe Domain Sequences for d3is7l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3is7l_ a.25.1.1 (L:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
gdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklieri
lfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllkd
ileseeehidyletqlgliqkvglenylqshmhe

SCOPe Domain Coordinates for d3is7l_:

Click to download the PDB-style file with coordinates for d3is7l_.
(The format of our PDB-style files is described here.)

Timeline for d3is7l_: