SCOPe 2.04: Domain d3ilqc2: 3ilq C:186-279

Lineage for d3ilqc2 (3ilq C:186-279)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (9 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries)

8. Domain d3ilqc2: 3ilq C:186-279 [199552]
   Other proteins in same PDB: d3ilqc1, d3ilqd_
   automated match to d1onqa1
   complexed with 1o2, nag

Details for d3ilqc2

PDB Entry: 3ilq, 2.05 Å

PDB Description: structure of mcd1d with bound glycolipid bbgl-2c from borrelia burgdorferi

PDB Compounds: (C:) T-cell surface glycoprotein CD1d1

SCOPe Domain Sequences for d3ilqc2:

Sequence, based on SEQRES records:

>d3ilqc2 b.1.1.2 (C:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssadghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

Sequence, based on observed residues (ATOM records):

>d3ilqc2 b.1.1.2 (C:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqatldv
eageeaglacrvkhsslggqdiilyw

Timeline for d3ilqc2:

• d3ilqc2 first appeared in SCOPe 2.03
  
• d3ilqc2 appears in SCOPe 2.05
  
• d3ilqc2 appears in the current release, SCOPe 2.08