Lineage for d3ilqc1 (3ilq C:7-185)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2545715Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2545716Protein automated matches [226842] (5 species)
    not a true protein
  7. 2545946Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries)
  8. 2545950Domain d3ilqc1: 3ilq C:7-185 [199551]
    Other proteins in same PDB: d3ilqc2, d3ilqd_
    automated match to d1onqa2
    complexed with 1o2, nag

Details for d3ilqc1

PDB Entry: 3ilq (more details), 2.05 Å

PDB Description: structure of mcd1d with bound glycolipid bbgl-2c from borrelia burgdorferi
PDB Compounds: (C:) T-cell surface glycoprotein CD1d1

SCOPe Domain Sequences for d3ilqc1:

Sequence, based on SEQRES records: (download)

>d3ilqc1 d.19.1.0 (C:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Sequence, based on observed residues (ATOM records): (download)

>d3ilqc1 d.19.1.0 (C:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemyasesflhvafqgkyvvrfw
gtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOPe Domain Coordinates for d3ilqc1:

Click to download the PDB-style file with coordinates for d3ilqc1.
(The format of our PDB-style files is described here.)

Timeline for d3ilqc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ilqc2
View in 3D
Domains from other chains:
(mouse over for more information)
d3ilqd_