SCOPe 2.08: Domain d3ilqc1: 3ilq C:7-185

Lineage for d3ilqc1 (3ilq C:7-185)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries)

8. Domain d3ilqc1: 3ilq C:7-185 [199551]
   Other proteins in same PDB: d3ilqc2, d3ilqd_
   automated match to d1onqa2
   complexed with 1o2, nag

Details for d3ilqc1

PDB Entry: 3ilq, 2.05 Å

PDB Description: structure of mcd1d with bound glycolipid bbgl-2c from borrelia burgdorferi

PDB Compounds: (C:) T-cell surface glycoprotein CD1d1

SCOPe Domain Sequences for d3ilqc1:

Sequence, based on SEQRES records:

>d3ilqc1 d.19.1.0 (C:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Sequence, based on observed residues (ATOM records):

>d3ilqc1 d.19.1.0 (C:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemyasesflhvafqgkyvvrfw
gtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Timeline for d3ilqc1:

• d3ilqc1 first appeared in SCOPe 2.03
  
• d3ilqc1 appears in SCOPe 2.07