| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
| Domain d3ilpa2: 3ilp A:186-279 [199550] Other proteins in same PDB: d3ilpa1, d3ilpb_ automated match to d1onqa1 complexed with 1l2, dms, nag |
PDB Entry: 3ilp (more details), 1.85 Å
SCOPe Domain Sequences for d3ilpa2:
Sequence, based on SEQRES records: (download)
>d3ilpa2 b.1.1.2 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssadghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw
>d3ilpa2 b.1.1.2 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssaghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwy
lqatldveageeaglacrvkhsslggqdiilyw
Timeline for d3ilpa2: