SCOPe 2.08: Domain d3ibxa1: 3ibx A:1-217

Lineage for d3ibxa1 (3ibx A:1-217)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.0: automated matches [191333] (1 protein)
   not a true family

6. Protein automated matches [190172] (9 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:210] [189118] (2 PDB entries)

8. Domain d3ibxa1: 3ibx A:1-217 [199546]
   Other proteins in same PDB: d3ibxa2, d3ibxd2
   automated match to d3ibxd_

Details for d3ibxa1

PDB Entry: 3ibx, 2.4 Å

PDB Description: crystal structure of f47y variant of tena (hp1287) from helicobacter pylori

PDB Compounds: (A:) Putative thiaminase II

SCOPe Domain Sequences for d3ibxa1:

Sequence; same for both SEQRES and ATOM records:

>d3ibxa1 a.132.1.0 (A:1-217) automated matches {Helicobacter pylori [TaxId: 210]}
mqvsqylyqnaqsiwgdcishpfvqgigrgtlerdkfrfyiiqdylylleyakvfalgvv
kacdeavmrefsnaiqdilnnemsihnhyirelqitqkelqnacptlanksytsymlaeg
fkgsikevaaavlscgwsylviaqnlsqipnalehafyghwikgysskefqacvnwninl
ldsltlasskqeieklkeifittseyeylfwdmayqs

Timeline for d3ibxa1:

• d3ibxa1 first appeared in SCOPe 2.03, called d3ibxa_
  
• d3ibxa1 appears in SCOPe 2.07