SCOPe 2.03: Domain d3i8va_: 3i8v A:

Lineage for d3i8va_ (3i8v A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein automated matches [190370] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187208] (22 PDB entries)

8. Domain d3i8va_: 3i8v A: [199542]
   automated match to d3i8vb_
   complexed with 0mo, co, gol, mg, zn

Details for d3i8va_

PDB Entry: 3i8v, 2.25 Å

PDB Description: Crystal structure of human PDE4a with 4-(3-butoxy-4-methoxyphenyl)methyl-2-imidazolidone

PDB Compounds: (A:) cAMP-specific 3',5'-cyclic phosphodiesterase 4A

SCOPe Domain Sequences for d3i8va_:

Sequence; same for both SEQRES and ATOM records:

>d3i8va_ a.211.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmniprfgvktdqeellaqelenlnkwglnifcvsdyaggrsltcimymifqerdllkkf
ripvdtmvtymltledhyhadvayhnslhaadvlqsthvllatpaldavftdleilaalf
aaaihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqedncdifqnlskr
qrqslrkmvidmvlatdmskhmtlladlktmvetkkvtssgvllldnysdriqvlrnmvh
cadlsnptkplelyrqwtdrimaeffqqgdrerergmeispmcdkhtasveksqvgfidy
ivhplwetwadlvhpdaqeildtlednrdwyysai

Timeline for d3i8va_:

• d3i8va_ is new in SCOPe 2.03-stable
  
• d3i8va_ appears in SCOPe 2.04
  
• d3i8va_ appears in the current release, SCOPe 2.08, called d3i8va1