SCOPe 2.07: Domain d3i0sa1: 3i0s A:1-429

Lineage for d3i0sa1 (3i0s A:1-429)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)

6. Protein HIV-1 reverse transcriptase [56689] (4 species)

7. Species Hiv-1 m:b_hxb2r [TaxId:11706] [190022] (22 PDB entries)

8. Domain d3i0sa1: 3i0s A:1-429 [199538]
   Other proteins in same PDB: d3i0sa2, d3i0sa3
   automated match to d1bqna2
   protein/DNA complex; protein/RNA complex; complexed with rt7

Details for d3i0sa1

PDB Entry: 3i0s, 2.7 Å

PDB Description: crystal structure of HIV reverse transcriptase in complex with inhibitor 7

PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d3i0sa1:

Sequence; same for both SEQRES and ATOM records:

>d3i0sa1 e.8.1.2 (A:1-429) HIV-1 reverse transcriptase {Hiv-1 m:b_hxb2r [TaxId: 11706]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

Timeline for d3i0sa1:

• d3i0sa1 first appeared in SCOPe 2.03
  
• d3i0sa1 appears in SCOPe 2.06
  
• d3i0sa1 appears in the current release, SCOPe 2.08