Lineage for d3hujh1 (3huj H:1-118)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519212Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)
  8. 1519853Domain d3hujh1: 3huj H:1-118 [199534]
    Other proteins in same PDB: d3huja1, d3huja2, d3hujb_, d3hujc1, d3hujc2, d3hujd_, d3huje2, d3hujf2, d3hujg2, d3hujh2
    automated match to d1ktke1
    complexed with agh, mg, nag, ndg

Details for d3hujh1

PDB Entry: 3huj (more details), 2.5 Å

PDB Description: crystal structure of human cd1d-alpha-galactosylceramide in complex with semi-invariant nkt cell receptor
PDB Compounds: (H:) NKT15 T cell receptor beta-chain

SCOPe Domain Sequences for d3hujh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hujh1 b.1.1.0 (H:1-118) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eadiyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstekgdl
ssestvsrirtehfpltlesarpshtsqylcassglrdrglyeqyfgpgtrltvte

SCOPe Domain Coordinates for d3hujh1:

Click to download the PDB-style file with coordinates for d3hujh1.
(The format of our PDB-style files is described here.)

Timeline for d3hujh1: