Lineage for d3hujg2 (3huj G:118-206)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2029210Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)
  8. 2029741Domain d3hujg2: 3huj G:118-206 [199533]
    Other proteins in same PDB: d3huja1, d3huja2, d3huja3, d3hujb_, d3hujc1, d3hujc2, d3hujc3, d3hujd_, d3huje1, d3hujf1, d3hujg1, d3hujh1
    automated match to d1qrnd2
    complexed with agh, mg, nag, ndg

Details for d3hujg2

PDB Entry: 3huj (more details), 2.5 Å

PDB Description: crystal structure of human cd1d-alpha-galactosylceramide in complex with semi-invariant nkt cell receptor
PDB Compounds: (G:) NKT15 T cell receptor alpha-chain

SCOPe Domain Sequences for d3hujg2:

Sequence, based on SEQRES records: (download)

>d3hujg2 b.1.1.2 (G:118-206) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records): (download)

>d3hujg2 b.1.1.2 (G:118-206) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdsvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsa
vawsnksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d3hujg2:

Click to download the PDB-style file with coordinates for d3hujg2.
(The format of our PDB-style files is described here.)

Timeline for d3hujg2: