Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (16 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries) |
Domain d3hujf2: 3huj F:119-247 [199531] Other proteins in same PDB: d3huja1, d3huja2, d3huja3, d3hujb_, d3hujc1, d3hujc2, d3hujc3, d3hujd_, d3huje1, d3hujf1, d3hujg1, d3hujh1 automated match to d1ktke2 complexed with agh, mg, nag, ndg |
PDB Entry: 3huj (more details), 2.5 Å
SCOPe Domain Sequences for d3hujf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hujf2 b.1.1.2 (F:119-247) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv saeawgrad
Timeline for d3hujf2: