SCOPe 2.04: Domain d3huje1: 3huj E:1-117

Lineage for d3huje1 (3huj E:1-117)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d3huje1: 3huj E:1-117 [199528]
   Other proteins in same PDB: d3huja1, d3huja2, d3hujb_, d3hujc1, d3hujc2, d3hujd_, d3huje2, d3hujf2, d3hujg2, d3hujh2
   automated match to d1qrnd1
   complexed with agh, mg, nag, ndg

Details for d3huje1

PDB Entry: 3huj, 2.5 Å

PDB Description: crystal structure of human cd1d-alpha-galactosylceramide in complex with semi-invariant nkt cell receptor

PDB Compounds: (E:) NKT15 T cell receptor alpha-chain

SCOPe Domain Sequences for d3huje1:

Sequence; same for both SEQRES and ATOM records:

>d3huje1 b.1.1.0 (E:1-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nqveqspqsliilegknctlqcnytvspfsnlrwykqdtgrgpvsltimtfsentksngr
ytatldadtkqsslhitasqlsdsasyicvvsdrgstlgrlyfgrgtqltvwpd

Timeline for d3huje1:

• d3huje1 first appeared in SCOPe 2.03
  
• d3huje1 appears in SCOPe 2.05
  
• d3huje1 appears in the current release, SCOPe 2.08