Lineage for d3huja2 (3huj A:184-280)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1514356Protein CD1, alpha-3 domain [88615] (5 species)
  7. Species Human (Homo sapiens), CD1a [TaxId:9606] [101513] (5 PDB entries)
  8. 1514365Domain d3huja2: 3huj A:184-280 [199525]
    Other proteins in same PDB: d3huja1, d3hujb_, d3hujc1, d3hujd_, d3huje1, d3huje2, d3hujf1, d3hujf2, d3hujg1, d3hujg2, d3hujh1, d3hujh2
    automated match to d1onqa1
    complexed with agh, mg, nag, ndg

Details for d3huja2

PDB Entry: 3huj (more details), 2.5 Å

PDB Description: crystal structure of human cd1d-alpha-galactosylceramide in complex with semi-invariant nkt cell receptor
PDB Compounds: (A:) T-cell surface glycoprotein CD1d

SCOPe Domain Sequences for d3huja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3huja2 b.1.1.2 (A:184-280) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]}
qvkpkawlsrgpspgpgrlllvchvsgfypkpvwvkwmrgeqeqqgtqpgdilpnadetw
ylratldvvageaaglscrvkhsslegqdivlywhhh

SCOPe Domain Coordinates for d3huja2:

Click to download the PDB-style file with coordinates for d3huja2.
(The format of our PDB-style files is described here.)

Timeline for d3huja2: