SCOPe 2.03: Domain d3hpta1: 3hpt A:90-126

Lineage for d3hpta1 (3hpt A:90-126)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein automated matches [190092] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187310] (65 PDB entries)

8. Domain d3hpta1: 3hpt A:90-126 [199518]
   Other proteins in same PDB: d3hptb_, d3hptd_
   automated match to d1xkal1
   complexed with act, ca, dms, gol, mes, na, yet

Details for d3hpta1

PDB Entry: 3hpt, 2.19 Å

PDB Description: crystal structure of human fxa in complex with (s)-2-cyano-1-(2- methylbenzofuran-5-yl)-3-(2-oxo-1-(2-oxo-2-(pyrrolidin-1-yl)ethyl) azepan-3-yl)guanidine

PDB Compounds: (A:) coagulation factor x

SCOPe Domain Sequences for d3hpta1:

Sequence, based on SEQRES records:

>d3hpta1 g.3.11.1 (A:90-126) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cetspcqnqgkckdglgeytctclegfegkncelftr

Sequence, based on observed residues (ATOM records):

>d3hpta1 g.3.11.1 (A:90-126) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cspcqnqgkckdeytctclegfegkncelftr

Timeline for d3hpta1:

• d3hpta1 is new in SCOPe 2.03-stable
  
• d3hpta1 appears in SCOPe 2.04
  
• d3hpta1 appears in the current release, SCOPe 2.08