SCOPe 2.03: Domain d3hjwa2: 3hjw A:252-337

Lineage for d3hjwa2 (3hjw A:252-337)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (14 families)

5. Family b.122.1.0: automated matches [191599] (1 protein)
   not a true family

6. Protein automated matches [191089] (6 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:2261] [225693] (2 PDB entries)

8. Domain d3hjwa2: 3hjw A:252-337 [199517]
   Other proteins in same PDB: d3hjwa1, d3hjwb_
   automated match to d2apoa1
   protein/RNA complex; complexed with k, zn

Details for d3hjwa2

PDB Entry: 3hjw, 2.35 Å

PDB Description: structure of a functional ribonucleoprotein pseudouridine synthase bound to a substrate rna

PDB Compounds: (A:) Pseudouridine synthase Cbf5

SCOPe Domain Sequences for d3hjwa2:

Sequence; same for both SEQRES and ATOM records:

>d3hjwa2 b.122.1.0 (A:252-337) automated matches {Pyrococcus furiosus [TaxId: 2261]}
hlpkvwikdsavaavthgadlavpgiaklhagikrgdlvaimtlkdelvalgkammtsqe
mlektkgiavdvekvfmprdwypklw

Timeline for d3hjwa2:

• d3hjwa2 is new in SCOPe 2.03-stable
  
• d3hjwa2 appears in SCOPe 2.04
  
• d3hjwa2 appears in the current release, SCOPe 2.08