Lineage for d3hjwa2 (3hjw A:252-337)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2823864Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2823865Superfamily b.122.1: PUA domain-like [88697] (15 families) (S)
  5. 2824132Family b.122.1.0: automated matches [191599] (1 protein)
    not a true family
  6. 2824133Protein automated matches [191089] (10 species)
    not a true protein
  7. 2824290Species Pyrococcus furiosus [TaxId:2261] [225693] (3 PDB entries)
  8. 2824292Domain d3hjwa2: 3hjw A:252-337 [199517]
    Other proteins in same PDB: d3hjwa1, d3hjwb_
    automated match to d2apoa1
    protein/RNA complex; complexed with k, zn

Details for d3hjwa2

PDB Entry: 3hjw (more details), 2.35 Å

PDB Description: structure of a functional ribonucleoprotein pseudouridine synthase bound to a substrate rna
PDB Compounds: (A:) Pseudouridine synthase Cbf5

SCOPe Domain Sequences for d3hjwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hjwa2 b.122.1.0 (A:252-337) automated matches {Pyrococcus furiosus [TaxId: 2261]}
hlpkvwikdsavaavthgadlavpgiaklhagikrgdlvaimtlkdelvalgkammtsqe
mlektkgiavdvekvfmprdwypklw

SCOPe Domain Coordinates for d3hjwa2:

Click to download the PDB-style file with coordinates for d3hjwa2.
(The format of our PDB-style files is described here.)

Timeline for d3hjwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hjwa1
View in 3D
Domains from other chains:
(mouse over for more information)
d3hjwb_