Class b: All beta proteins [48724] (180 folds) |
Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
Superfamily b.122.1: PUA domain-like [88697] (15 families) |
Family b.122.1.0: automated matches [191599] (1 protein) not a true family |
Protein automated matches [191089] (10 species) not a true protein |
Species Pyrococcus furiosus [TaxId:2261] [225693] (3 PDB entries) |
Domain d3hjwa2: 3hjw A:252-337 [199517] Other proteins in same PDB: d3hjwa1, d3hjwb_ automated match to d2apoa1 protein/RNA complex; complexed with k, zn |
PDB Entry: 3hjw (more details), 2.35 Å
SCOPe Domain Sequences for d3hjwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hjwa2 b.122.1.0 (A:252-337) automated matches {Pyrococcus furiosus [TaxId: 2261]} hlpkvwikdsavaavthgadlavpgiaklhagikrgdlvaimtlkdelvalgkammtsqe mlektkgiavdvekvfmprdwypklw
Timeline for d3hjwa2: