Lineage for d3hjta_ (3hjt A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143226Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2143333Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2143580Family c.92.2.0: automated matches [191548] (1 protein)
    not a true family
  6. 2143581Protein automated matches [190944] (35 species)
    not a true protein
  7. 2143668Species Streptococcus agalactiae [TaxId:1311] [196503] (1 PDB entry)
  8. 2143669Domain d3hjta_: 3hjt A: [199515]
    automated match to d3hjtb_
    complexed with zn

Details for d3hjta_

PDB Entry: 3hjt (more details), 2.5 Å

PDB Description: Structure of laminin binding protein (Lmb) of Streptococcus agalactiae A bifunctional protein with adhesin and metal transporting activity
PDB Compounds: (A:) Lmb

SCOPe Domain Sequences for d3hjta_:

Sequence, based on SEQRES records: (download)

>d3hjta_ c.92.2.0 (A:) automated matches {Streptococcus agalactiae [TaxId: 1311]}
qgmsvvtsfypmyamtkevsgdlndvrmiqsgagihsfepsvndvaaiydadlfvyhsht
leawardldpnlkkskvnvfeaskpltldrvkgledmevtqgidpatlydphtwtdpvla
geeavniakelghldpkhkdsytkkakafkkeaeqlteeytqkfkkvrsktfvtqhtafs
ylakrfglkqlgisgispeqepsprqlkeiqdfvkeynvktifaednvnpkiahaiakst
gakvktlspleaapsgnktylenlranlevlyqqlk

Sequence, based on observed residues (ATOM records): (download)

>d3hjta_ c.92.2.0 (A:) automated matches {Streptococcus agalactiae [TaxId: 1311]}
qgmsvvtsfypmyamtkevsgdlndvrmiqsgagihsfepsvndvaaiydadlfvyhsht
leawardldpkskvnvfeaskpltldrvkgtlydphtwtdpvlageeavniakelghldp
khkdsytkkakafkkeaeqlteeytqkfkkvrsktfvtqhtafsylakrfglkqlgisgi
speqepsprqlkeiqdfvkeynvktifaednvnpkiahaiakstgakvktlspleaapsg
nktylenlranlevlyqqlk

SCOPe Domain Coordinates for d3hjta_:

Click to download the PDB-style file with coordinates for d3hjta_.
(The format of our PDB-style files is described here.)

Timeline for d3hjta_: