Lineage for d3hi6y2 (3hi6 Y:107-210)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1517240Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)
  8. 1517380Domain d3hi6y2: 3hi6 Y:107-210 [199514]
    Other proteins in same PDB: d3hi6a_, d3hi6b_, d3hi6l1, d3hi6y1
    automated match to d3fcta2
    complexed with mn, so4

Details for d3hi6y2

PDB Entry: 3hi6 (more details), 2.3 Å

PDB Description: crystal structure of intermediate affinity i domain of integrin lfa-1 with the fab fragment of its antibody al-57
PDB Compounds: (Y:) light chain of Fab fragment of AL-57 against alpha L I domain

SCOPe Domain Sequences for d3hi6y2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hi6y2 b.1.1.2 (Y:107-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d3hi6y2:

Click to download the PDB-style file with coordinates for d3hi6y2.
(The format of our PDB-style files is described here.)

Timeline for d3hi6y2: