Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries) |
Domain d3hi6y2: 3hi6 Y:107-210 [199514] Other proteins in same PDB: d3hi6a_, d3hi6b_, d3hi6l1, d3hi6y1 automated match to d3fcta2 complexed with mn, so4 |
PDB Entry: 3hi6 (more details), 2.3 Å
SCOPe Domain Sequences for d3hi6y2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hi6y2 b.1.1.2 (Y:107-210) automated matches {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr
Timeline for d3hi6y2:
View in 3D Domains from other chains: (mouse over for more information) d3hi6a_, d3hi6b_, d3hi6l1, d3hi6l2 |