Lineage for d3hi6l1 (3hi6 L:2-106)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1295971Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)
  8. 1296180Domain d3hi6l1: 3hi6 L:2-106 [199511]
    Other proteins in same PDB: d3hi6a_, d3hi6b_, d3hi6l2, d3hi6y2
    automated match to d3fcta1
    complexed with mn, so4

Details for d3hi6l1

PDB Entry: 3hi6 (more details), 2.3 Å

PDB Description: crystal structure of intermediate affinity i domain of integrin lfa-1 with the fab fragment of its antibody al-57
PDB Compounds: (L:) light chain of Fab fragment of AL-57 against alpha L I domain

SCOPe Domain Sequences for d3hi6l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hi6l1 b.1.1.0 (L:2-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqmtqspsslsasvgdrvtitcrasqsigsylnwyqqktgkapkaliyaasslqsgvpsr
fsgsgsgtdftltisslqledfatyycqqsystpsfgqgtkveik

SCOPe Domain Coordinates for d3hi6l1:

Click to download the PDB-style file with coordinates for d3hi6l1.
(The format of our PDB-style files is described here.)

Timeline for d3hi6l1: